GCET2 (GCSAM) Rabbit Polyclonal Antibody

SKU TA330926

Rabbit polyclonal Anti-GCET2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GCET2 antibody: synthetic peptide directed towards the middle region of human GCET2. Synthetic peptide located within the following region: YSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 21 kDa
• Gene Name: germinal center associated signaling and motility
• Database Link:
  NP_689998
  Q8N6F7
• Background: GCET2 is a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4.This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Synonyms: GCAT2; GCET2; HGAL
• Note: Human: 100%

Reference Data