NUF2 Rabbit Polyclonal Antibody

CAT#: TA330907

Rabbit Polyclonal Anti-NUF2 Antibody

Product Images

Host: Rabbit; Target Name: NUF2; Sample Tissue: RPMI-8226 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NUF2 antibody is: synthetic peptide directed towards the N-terminal region of Human NUF2. Synthetic peptide located within the following region: EIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: NUF2, NDC80 kinetochore complex component
• Database Link:
  NP_663735
  Entrez Gene 83540 Human
  UniProt ID Q9BZD4
• Background: The function of this protein remains unknown.
• Synonyms: CDCA1; CT106; NUF2R
• Note: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome