NEURL1B Rabbit Polyclonal Antibody

SKU TA330881

Rabbit Polyclonal Anti-NEURL1B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NEURL1B antibody is: synthetic peptide directed towards the C-terminal region of Human NEURL1B. Synthetic peptide located within the following region: GQLRLLGTLQSSPATTTPSGSLSGSQDDSDSDMTFSVNQSSSASESSLVT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: neuralized E3 ubiquitin protein ligase 1B
• Database Link:
  NP_001136123
  A8MQ27
• Background: NEURL1B is an E3 ubiquitin-protein ligase involved in regulation of the Notch pathway through influencing the stability and activity of several Notch ligands.
• Synonyms: hNeur2; neur2; NEURL3
• Note: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 92%

Reference Data