ZNF772 Rabbit Polyclonal Antibody

SKU
TA330839
Rabbit Polyclonal Anti-ZNF772 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZNF772 antibody is: synthetic peptide directed towards the middle region of Human ZNF772. Synthetic peptide located within the following region: SFVTGEACKDFLASSSIFEHHAPHNEWKPHSNTKCEEASHCGKRHYKCSE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 53 kDa
Gene Name zinc finger protein 772
Database Link
Background ZNF772 may be involved in transcriptional regulation.
Synonyms DKFZp686I1569
Note Human: 100%; Horse: 79%
Reference Data
Write Your Own Review
You're reviewing:ZNF772 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.