WDR59 Rabbit Polyclonal Antibody

SKU
TA330824
Rabbit Polyclonal Anti-WDR59 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-WDR59 antibody is: synthetic peptide directed towards the C-terminal region of Human WDR59. Synthetic peptide located within the following region: TRSEKEQVSISSFYYKERKSRRWKSKREGSDSGNRQIKAAGKVIIQDIAC
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 109 kDa
Gene Name WD repeat domain 59
Database Link
Background The function of this protein remains unknown.
Synonyms FP977
Note Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86%
Reference Data
Write Your Own Review
You're reviewing:WDR59 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.