USP43 Rabbit Polyclonal Antibody

SKU TA330816

Rabbit Polyclonal Anti-USP43 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-USP43 antibody is: synthetic peptide directed towards the C-terminal region of Human USP43. Synthetic peptide located within the following region: KSSPPSPYMGFSGNSKDSRRGTSELDRPLQGTLTLLRSVFRKKENRRNER
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 69 kDa
• Gene Name: ubiquitin specific peptidase 43
• Database Link:
  NP_694942
  Q70EL4
• Background: USP43 may recognize and hydrolyze the peptide bond at the C-terminal Gly of ubiquitin. It is involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.
• Synonyms: FLJ30626
• Note: Human: 100%

Reference Data

• Protein Families: Druggable Genome