TTC30A Rabbit Polyclonal Antibody

SKU TA330806

Rabbit Polyclonal Anti-TTC30A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TTC30A antibody is: synthetic peptide directed towards the C-terminal region of Human TTC30A. Synthetic peptide located within the following region: IEKEEEQLSYDDPNRKMYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 76 kDa
• Gene Name: tetratricopeptide repeat domain 30A
• Database Link:
  NP_689488
  Q86WT1
• Background: TTC30A is required for polyglutamylation of axonemal tubulin. It plays a role in anterograde intraflagellar transport (IFT), the process by which cilia precursors are transported from the base of the cilium to the site of their incorporation at the tip.
• Synonyms: IFT70A
• Note: Human: 100%; Dog: 79%; Rat: 79%; Bovine: 79%; Rabbit: 79%

Reference Data