TMPRSS7 Rabbit Polyclonal Antibody

SKU TA330792

Rabbit Polyclonal Anti-TMPRSS7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TMPRSS7 antibody is: synthetic peptide directed towards the N-terminal region of Human TMPRSS7. Synthetic peptide located within the following region: LPEYRQKESREFLSVSRTVQQVINLVYTTSAFSKFYEQSVVADVSNNKGG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 78 kDa
• Gene Name: transmembrane protease, serine 7
• Database Link:
  NP_001036040
  Q7RTY8
• Background: TMPRSS7 is a Serine protease which preferentially hydrolyzes peptides with Arg at the P1 position.
• Synonyms: B230219I23Rik; Gm1748; matriptase-3; transmembrane serine protease 7
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome