TMEM177 Rabbit Polyclonal Antibody

SKU
TA330787
Rabbit Polyclonal Anti-TMEM177 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TMEM177 antibody is: synthetic peptide directed towards the C-terminal region of Human TMEM177. Synthetic peptide located within the following region: AYACGGVEFYEKLLSGNLALRSLLGKDGEKLYTPSGNIVPRHLFRIKHLP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 34 kDa
Gene Name transmembrane protein 177
Database Link
Background The function of this protein remains unknown.
Synonyms MGC10993
Note Rat: 100%; Human: 100%; Dog: 86%; Pig: 86%; Mouse: 86%; Guinea pig: 86%; Horse: 79%; Rabbit: 79%
Reference Data
Write Your Own Review
You're reviewing:TMEM177 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.