TMED5 Rabbit Polyclonal Antibody

SKU TA330775

Rabbit Polyclonal Anti-TMED5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TMED5 antibody is: synthetic peptide directed towards the C-terminal region of Human TMED5. Synthetic peptide located within the following region: INSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSMVNLVVMVVV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 23 kDa
• Gene Name: transmembrane p24 trafficking protein 5
• Database Link:
  NP_057124
  Q9Y3A6
• Background: TMED5 is a potential role in vesicular protein trafficking, mainly in the early secretory pathway. It is required for the maintenance of the Golgi apparatus; involved in protein exchange between Golgi stacks during assembly. It probably not required for COPI-vesicle-mediated retrograde transport.
• Synonyms: CGI-100; p24g2; p28
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane