ARMC9 Rabbit Polyclonal Antibody

CAT#: TA330768

Reviews ()
Write a review

Rabbit Polyclonal Anti-ARMC9 Antibody



Get 29% off western blot control. View details.

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ARMC9 antibody is: synthetic peptide directed towards the N-terminal region of Human ARMC9. Synthetic peptide located within the following region: DSFAQKLEFYLHIHFAIYLLKYSVGRPDKEELDEKISYFKTYLETKGAAL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 75 kDa
Gene Name armadillo repeat containing 9
Background The function of this protein remains unknown.
Synonyms ARM; KU-MEL-1; NS21
Note Human: 100%; Pig: 93%; Horse: 86%; Rat: 83%; Rabbit: 83%; Dog: 79%; Bovine: 79%
Reference Data
Other products for "ARMC9"
Frequently bought together (3)
Recombinant protein of human armadillo repeat containing 9 (ARMC9)
    • 20 ug

USD 748.00


Transient overexpression lysate of armadillo repeat containing 9 (ARMC9)
    • 100 ug

USD 360.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies