Tbc1d17 Rabbit Polyclonal Antibody

SKU TA330745

Rabbit Polyclonal Anti-Tbc1d17 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Tbc1d17 antibody is: synthetic peptide directed towards the middle region of Mouse Tbc1d17. Synthetic peptide located within the following region: FCGFMELVHGNFEESQETMKRQLGQLLLLLRVLDQPLCDFLDSQDSGSLC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 72 kDa
• Gene Name: TBC1 domain family, member 17
• Database Link:
  NP_001036120
  Q8BYH7
• Background: Tbc1d17 may act as a GTPase-activating protein for Rab family protein(s).
• Synonyms: BC017607; MGC27642
• Note: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Goat: 80%; Zebrafish: 77%

Reference Data