C6orf211 (ARMT1) Rabbit Polyclonal Antibody

SKU
TA330735
Rabbit Polyclonal Anti-C6orf211 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-C6orf211 antibody is: synthetic peptide directed towards the N-terminal region of Human C6orf211. Synthetic peptide located within the following region: SDGKSRWFYSPWLLVECYMYRRIHEAIIQSPPIDYFDVFKESKEQNFYGS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 51 kDa
Gene Name acidic residue methyltransferase 1
Database Link
Background The function of this protein remains unknown.
Synonyms C6orf211
Note Human: 100%; Dog: 86%; Pig: 79%; Rat: 79%; Horse: 79%; Mouse: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data
Write Your Own Review
You're reviewing:C6orf211 (ARMT1) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.