SERTAD4 Rabbit Polyclonal Antibody

SKU
TA330699
Rabbit Polyclonal Anti-SERTAD4 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SERTAD4 antibody is: synthetic peptide directed towards the C-terminal region of Human SERTAD4. Synthetic peptide located within the following region: VGNDLAFECKGQFYDYFETGYNERNNVNESWKKSLRKKEASPPSNKLCCS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 39 kDa
Gene Name SERTA domain containing 4
Database Link
Background The function of this protein remains unknown.
Synonyms DJ667H12.2
Note Human: 100%; Dog: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Rabbit: 83%; Pig: 80%; Guinea pig: 80%
Reference Data
Write Your Own Review
You're reviewing:SERTAD4 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.