SERTAD4 Rabbit Polyclonal Antibody

SKU TA330699

Rabbit Polyclonal Anti-SERTAD4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SERTAD4 antibody is: synthetic peptide directed towards the C-terminal region of Human SERTAD4. Synthetic peptide located within the following region: VGNDLAFECKGQFYDYFETGYNERNNVNESWKKSLRKKEASPPSNKLCCS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: SERTA domain containing 4
• Database Link:
  NP_062551
  Q9NUC0
• Background: The function of this protein remains unknown.
• Synonyms: DJ667H12.2
• Note: Human: 100%; Dog: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Rabbit: 83%; Pig: 80%; Guinea pig: 80%

Reference Data