C1orf112 Rabbit Polyclonal Antibody

SKU TA330692

Rabbit Polyclonal Anti-C1orf112 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C1orf112 antibody is: synthetic peptide directed towards the C-terminal region of Human C1orf112. Synthetic peptide located within the following region: TEAAKVERVKQEKGIFWEPFANVTVEEAKRSSLQPYAKRARQEFPWEEEY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 78 kDa
• Gene Name: chromosome 1 open reading frame 112
• Database Link:
  NP_060656
  Q9NSG2
• Background: The function of this protein remains unknown.
• Synonyms: RP1-97P20.1
• Note: Human: 100%; Pig: 86%; Dog: 85%; Horse: 85%; Bovine: 77%

Reference Data

• Protein Families: Druggable Genome