VPS50 Rabbit Polyclonal Antibody

SKU TA330687

Rabbit Polyclonal Anti-CCDC132 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CCDC132 antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC132. Synthetic peptide located within the following region: ELREQPSDPQAEQELINSIEQVYFSVDSFDIVKYELEKLPPVLNLQELEA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 107 kDa
• Gene Name: VPS50, EARP/GARPII complex subunit
• Database Link:
  NP_001244927
  Q96JG6
• Background: The function of this protein remains unknown.
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Zebrafish: 93%

Reference Data