SHFL Rabbit Polyclonal Antibody

SKU TA330678

Rabbit Polyclonal Anti-C19orf66 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C19orf66 antibody is: synthetic peptide directed towards the N-terminal region of Human C19orf66. Synthetic peptide located within the following region: FGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDRDIQAVATSL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: chromosome 19 open reading frame 66
• Database Link:
  NP_060851
  Q9NUL5
• Background: The function of this protein remains unknown.
• Synonyms: FLJ11286; FLJ40743
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%

Reference Data