POU2F3 Rabbit Polyclonal Antibody

CAT#: TA330590

Rabbit Polyclonal Anti-POU2F3 Antibody

Product Images

WB Suggested Anti-POU2F3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

• 

  Human Muscle

• 

  Sample Type : Mouse tongue tissuePrimary Antibody Dilution : 1:100Secondary Antibody : Anti-rabbit-Cy3Secondary Antibody Dilution : 1:500Color/Signal Descriptions : Red: POU2F3Gene Name : POU2F3Submitted by : Dr. Hong Wang, Monell Chemical Senses Center

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Rat, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-POU2F3 antibody: synthetic peptide directed towards the N terminal of human POU2F3. Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: POU class 2 homeobox 3
• Database Link:
  NP_055167
  Entrez Gene 18988 MouseEntrez Gene 116544 RatEntrez Gene 25833 Human
  UniProt ID Q9UKI9
• Background: POU domain genes encode a family of highly conserved transacting factors that influence the transcriptional activity of several cell type-specific and ubiquitous genes.
• Synonyms: Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%