DACH2 Rabbit Polyclonal Antibody

SKU TA330532

Rabbit Polyclonal Anti-DACH2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DACH2 antibody: synthetic peptide directed towards the C terminal of human DACH2. Synthetic peptide located within the following region: TKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 65 kDa
• Gene Name: dachshund family transcription factor 2
• Database Link:
  NP_444511
  Q96NX9
• Background: Most X autosome translocations associated with premature ovarian failure do not interrupt X-linked genes. Only one of the six breakpoints disrupts the DACH2 gene.
• Synonyms: FLJ31391; MGC138545
• Note: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Dog: 92%; Bovine: 92%

Reference Data

• Protein Families: Transcription Factors