PEX10 Rabbit Polyclonal Antibody

CAT#: TA330521

Rabbit Polyclonal Anti-PEX10 Antibody

Product Images

WB Suggested Anti-PEX10 Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T

• 

  Human Muscle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PEX10 antibody: synthetic peptide directed towards the middle region of human PEX10. Synthetic peptide located within the following region: QALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYRLLGVISLLHLVL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: peroxisomal biogenesis factor 10
• Database Link:
  NP_002608
  Entrez Gene 5192 Human
  UniProt ID O60683
• Background: PEX10 is a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in PEX10 gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome.This gene encodes a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in this gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome. Alternative splicing results in two transcript variants encoding different isoforms.
• Synonyms: NALD; PBD6A; PBD6B; RNF69
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane