NSMCE1 Rabbit Polyclonal Antibody

SKU TA330503

Rabbit Polyclonal Anti-NSMCE1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NSMCE1 antibody: synthetic peptide directed towards the middle region of human NSMCE1. Synthetic peptide located within the following region: KKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 31 kDa
• Gene Name: NSE1 homolog, SMC5-SMC6 complex component
• Database Link:
  NP_659547
  Q8WV22
• Background: NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks.
• Synonyms: NSE1
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome