RNF170 Rabbit Polyclonal Antibody

SKU TA330477

Rabbit Polyclonal Anti-RNF170 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RNF170 antibody: synthetic peptide directed towards the middle region of human RNF170. Synthetic peptide located within the following region: CIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: ring finger protein 170
• Database Link:
  NP_112216
  Q96K19
• Background: RNF170 is a multi-pass membrane proteinPotential. It contains 1 RING-type zinc finger. The exact function of RNF170 remains unknown.
• Synonyms: ADSA; SNAX1
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 91%; Dog: 81%; Horse: 75%

Reference Data

• Protein Families: Druggable Genome, Transmembrane