SRP72 Rabbit Polyclonal Antibody

CAT#: TA330406

Rabbit Polyclonal Anti-SRP72 Antibody

Product Images

WB Suggested Anti-SRP72 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: PANC1 cell lysateThere is BioGPS gene expression data showing that SRP72 is expressed in PANC1

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SRP72 antibody: synthetic peptide directed towards the middle region of human SRP72. Synthetic peptide located within the following region: GDSQPKEQGQGDLKKKKKKKKGKLPKNYDPKVTPDPERWLPMRERSYYRG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 74 kDa
• Gene Name: signal recognition particle 72kDa
• Database Link:
  NP_008878
  Entrez Gene 6731 Human
  UniProt ID O76094
• Background: Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP72 binds the 7S RNA only in presence of SRP68. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function.
• Synonyms: BMFF; BMFS1; HEL103
• Note: Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; African clawed frog: 86%; Zebrafish: 80%

Reference Data

• Protein Pathways: Protein export