SRP72 Rabbit Polyclonal Antibody

SKU TA330406

Rabbit Polyclonal Anti-SRP72 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SRP72 antibody: synthetic peptide directed towards the middle region of human SRP72. Synthetic peptide located within the following region: GDSQPKEQGQGDLKKKKKKKKGKLPKNYDPKVTPDPERWLPMRERSYYRG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 74 kDa
• Gene Name: signal recognition particle 72kDa
• Database Link:
  NP_008878
  O76094
• Background: Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP72 binds the 7S RNA only in presence of SRP68. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function.
• Synonyms: BMFF; BMFS1; HEL103
• Note: Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; African clawed frog: 86%; Zebrafish: 80%

Reference Data

• Protein Pathways: Protein export