TIAL1 Rabbit Polyclonal Antibody

SKU TA330340

Rabbit Polyclonal Anti-TIAL1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TIAL1 antibody: synthetic peptide directed towards the C terminal of human TIAL1. Synthetic peptide located within the following region: WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: TIA1 cytotoxic granule-associated RNA binding protein-like 1
• Database Link:
  NP_003243
  Q01085
• Background: The protein encoded by TIAL1 is a member of a family of RNA-binding proteins and possesses nucleolytic activity against cytotoxic lymphocyte target cells. The gene product is a cytotoxic granule-associated protein and has been shown to bind specifically to poly(A) homopolymers and to fragment DNA in permeabilized target cells. It has been suggested that members of this protein family may be involved in the induction of apoptosis. One isoform contains a lysosome-targeting motif in its C-terminal auxiliary domain; however, alternative splicing results in a T-cluster DNA-binding isoform, differing at the C-terminus where a hydrophobic sequence replaces the lysosome-targeting motif.
• Synonyms: TCBP; TIAR
• Note: Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Mouse: 85%; Rat: 85%; Zebrafish: 76%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors