Homeobox protein SIX6 (SIX6) Rabbit Polyclonal Antibody

SKU TA330276

Rabbit Polyclonal Anti-SIX6 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SIX6 antibody: synthetic peptide directed towards the N terminal of human SIX6. Synthetic peptide located within the following region: PAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQAL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 28 kDa
• Gene Name: SIX homeobox 6
• Database Link:
  NP_031400
  O95475
• Background: SIX6 is a member of SIX family. It is the homologue of the chick Six6(Optx2) gene. SIX6 is closely related to SIX3 and is expressed in the developing and adult human retina.
• Synonyms: MCOPCT2; ODRMD; OPTX2; Six9
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data