FOXE3 Rabbit Polyclonal Antibody

CAT#: TA330241

Rabbit Polyclonal Anti-FOXE3 Antibody


 Product Datasheet for 'TA330241'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB, IHC
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-FOXE3 antibody: synthetic peptide directed towards the C terminal of human FOXE3. Synthetic peptide located within the following region: PEPPCCAAPDAAAAAFPPCAAAASPPLYSQVPDRLVLPATRPGPGPLPAE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Predicted Protein Size 33kDa
Gene Name forkhead box E3
Background Forkhead Box Protein E3 (FOXE3, forkhead-related protein FKHL12, forkhead-related transcription factor 8) is a forkhead/winged helix transcription factor, which is expressed in the developing lens from the start of lens placode induction and becomes restricted to the anterior proliferating cells when lens fiber differentiation begins.
Synonyms FKHL12|FREAC8
Note Immunogen sequence homology: Human: 100%
Reference Data
Other products for "FOXE3"
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies