TAF7 Rabbit Polyclonal Antibody

SKU TA330161

Rabbit Polyclonal Anti-TAF7 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAF7 antibody: synthetic peptide directed towards the N terminal of human TAF7. Synthetic peptide located within the following region: MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: TATA-box binding protein associated factor 7
• Database Link:
  NP_005633
  Q15545
• Background: The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II.
• Synonyms: TAF2F; TAFII55
• Note: Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Guinea pig: 100%; Human: 100%; Pig: 100%; Rat: 100%; African clawed frog: 92%; Mouse: 92%; Zebrafish: 91%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Basal transcription factors