PC4 (SUB1) Rabbit Polyclonal Antibody

SKU TA330155

Rabbit Polyclonal Anti-SUB1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PC4 antibody: synthetic peptide directed towards the middle region of human PC4. Synthetic peptide located within the following region: NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 14 kDa
• Gene Name: SUB1 homolog, transcriptional regulator
• Database Link:
  NP_006704
  P53999
• Background: PC4 (activated RNA polymerase II transcription cofactor 4) is a transcriptional coactivator, possessing the ability to suppress promoter-driven as well as nonspecific transcription via its DNA binding activity. The repressive activity of PC4 on promoter-driven transcription is alleviated by transcription factor TFIIH. TFIIH protects promoters from PC4-mediated repression by relieving the topological constraint imposed by PC4 through the ERCC3 helicase activity.
• Synonyms: p14; P15; PC4
• Note: Immunogen sequence homology: Bovine:100%; Human:100%; African clawed frog:100%; Western clawed frog:100%; Rat:100%; Chicken:100%; Sumatran orangutan:100%; Zebrafish:100%; Crab-eating macaque:100%; Mouse:100%; Dog:100%; salmon louse:100%; Northern pike:100

Reference Data

• Protein Families: Transcription Factors