SNAP43 (SNAPC1) Rabbit Polyclonal Antibody

CAT#: TA330114

Rabbit Polyclonal Anti-SNAPC1 Antibody

Product Images

WB Suggested Anti-SNAPC1 Antibody Titration: 2.5ug/ml; Positive Control: Transfected 293T

• 

  Human Pancrease

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SNAPC1 antibody: synthetic peptide directed towards the C terminal of human SNAPC1. Synthetic peptide located within the following region: KMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENESLSGTEFTASKKRRKH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: small nuclear RNA activating complex polypeptide 1
• Database Link:
  NP_003073
  Entrez Gene 6617 Human
  UniProt ID Q16533
• Background: SNAPC1 is a part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. It binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes and recruits TBP and BRF2 to the U6 snRNA TATA box.
• Synonyms: PTFgamma; SNAP43
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors