HLX1 (HLX) Rabbit Polyclonal Antibody

SKU TA330095

Rabbit Polyclonal Anti-HLX Antibody

Product Data

• Application: IF, WB
• Recommended Dilution: WB, IF
• Reactivity: Human, Xenopus
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HLX1 antibody: synthetic peptide directed towards the middle region of human HLX1 (Cat# AAP31195). Synthetic peptide located within the following region: PGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 51 kDa
• Gene Name: H2.0 like homeobox
• Database Link:
  NP_068777
  Q14774
• Background: H2.0-like homeo box 1; H2.0 (Drosophilia)-like homeo box-1.
• Synonyms: HB24; HLX1
• Note: Immunogen sequence homology: Zebrafish: 92%

Reference Data

• Protein Families: Transcription Factors