TAF1 48 (TAF1A) Rabbit Polyclonal Antibody

SKU
TA330076
Rabbit Polyclonal Anti-TAF1A Antibody
$585.00
5 Days*
Specifications
Product Data
Application IHC, WB
Recommended Dilution IHC, WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TAF1A antibody: synthetic peptide directed towards the C terminal of human TAF1A. Synthetic peptide located within the following region: CEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIVNPRL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 40 kDa
Gene Name TATA-box binding protein associated factor, RNA polymerase I subunit A
Database Link
Background Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1A encodes the smallest SL1-specific TAF.
Synonyms MGC:17061; RAFI48; SL1; TAFI48
Note Immunogen sequence homology: Human: 100%; Dog: 85%; Horse: 85%; Mouse: 85%; Pig: 85%; Rabbit: 85%; Rat: 85%; Bovine: 78%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:TAF1 48 (TAF1A) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.