TAF1 48 (TAF1A) Rabbit Polyclonal Antibody

CAT#: TA330076

Rabbit Polyclonal Anti-TAF1A Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 2
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 1, 20 µg
    • 20 ug

USD 867.00

Other products for "TAF1 48"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution IHC, WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TAF1A antibody: synthetic peptide directed towards the C terminal of human TAF1A. Synthetic peptide located within the following region: CEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIVNPRL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 40 kDa
Gene Name TATA-box binding protein associated factor, RNA polymerase I subunit A
Background Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1A encodes the smallest SL1-specific TAF.
Synonyms MGC:17061; RAFI48; SL1; TAFI48
Note Immunogen sequence homology: Human: 100%; Dog: 85%; Horse: 85%; Mouse: 85%; Pig: 85%; Rabbit: 85%; Rat: 85%; Bovine: 78%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.