TAF1 48 (TAF1A) Rabbit Polyclonal Antibody

SKU TA330076

Rabbit Polyclonal Anti-TAF1A Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAF1A antibody: synthetic peptide directed towards the C terminal of human TAF1A. Synthetic peptide located within the following region: CEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIVNPRL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: TATA-box binding protein associated factor, RNA polymerase I subunit A
• Database Link:
  NP_647603
  Q15573
• Background: Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1A encodes the smallest SL1-specific TAF.
• Synonyms: MGC:17061; RAFI48; SL1; TAFI48
• Note: Immunogen sequence homology: Human: 100%; Dog: 85%; Horse: 85%; Mouse: 85%; Pig: 85%; Rabbit: 85%; Rat: 85%; Bovine: 78%

Reference Data

• Protein Families: Transcription Factors