TATA Element Modulatory Factor 1 (TMF1) Rabbit Polyclonal Antibody

CAT#: TA330047

Reviews ()
Write a review

Rabbit Polyclonal Anti-TMF1 Antibody


 Product Datasheet for 'TA330047'

USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TMF1 antibody: synthetic peptide directed towards the middle region of human TMF1. Synthetic peptide located within the following region: GNLEKTRSIMAEELVKLTNQNDELEEKVKEIPKLRTQLRDLDQRYNTILQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Predicted Protein Size 123 kDa
Gene Name TATA element modulatory factor 1
Background TMF1 binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP).
Synonyms ARA160; TMF
Note Immunogen sequence homology: Horse: 100%; Human: 100%; Rabbit: 100%; African clawed frog: 92%; Bovine: 92%; Guinea pig: 92%; Mouse: 92%; Rat: 92%; Chicken: 85%
Reference Data
Protein Families Transcription Factors
Other products for "TMF1"
Frequently bought together (2)
Transient overexpression lysate of TATA element modulatory factor 1 (TMF1)
    • 100 ug

USD 495.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
68 Mouse Clones