TATA Element Modulatory Factor 1 (TMF1) Rabbit Polyclonal Antibody

SKU TA330047

Rabbit Polyclonal Anti-TMF1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMF1 antibody: synthetic peptide directed towards the middle region of human TMF1. Synthetic peptide located within the following region: GNLEKTRSIMAEELVKLTNQNDELEEKVKEIPKLRTQLRDLDQRYNTILQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 123 kDa
• Gene Name: TATA element modulatory factor 1
• Database Link:
  NP_009045
  P82094
• Background: TMF1 binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP).
• Synonyms: ARA160; TMF
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Rabbit: 100%; African clawed frog: 92%; Bovine: 92%; Guinea pig: 92%; Mouse: 92%; Rat: 92%; Chicken: 85%

Reference Data

• Protein Families: Transcription Factors