PEDF (SERPINF1) Rabbit Polyclonal Antibody
Product Data | |
Application | IHC, WB |
---|---|
Recommended Dilution | WB, IHC |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SERPINF1 antibody: synthetic peptide directed towards the N terminal of human SERPINF1. Synthetic peptide located within the following region: GALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 46 kDa |
Gene Name | serpin family F member 1 |
Database Link | |
Background | The SERPINF1 gene may play a significant role in determining the balance of angiogenesis/ antiangiogenesis during atherogenesis. A novel role of extracellular phosphorylation is shown to completely change the nature of this gene from a neutrophic to an antiangiogenic factor. |
Synonyms | EPC-1; OI6; OI12; PEDF; PIG35 |
Note | Immunogen sequence homology: Human: 100%; Mouse: 86%; Sheep: 86%; Guinea pig: 80%; Horse: 80%; Pig: 80%; Dog: 78%; Rat: 75% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.