PEDF (SERPINF1) Rabbit Polyclonal Antibody

SKU TA330022

Rabbit Polyclonal Anti-SERPINF1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SERPINF1 antibody: synthetic peptide directed towards the N terminal of human SERPINF1. Synthetic peptide located within the following region: GALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: serpin family F member 1
• Database Link:
  NP_002606
  P36955
• Background: The SERPINF1 gene may play a significant role in determining the balance of angiogenesis/ antiangiogenesis during atherogenesis. A novel role of extracellular phosphorylation is shown to completely change the nature of this gene from a neutrophic to an antiangiogenic factor.
• Synonyms: EPC-1; OI6; OI12; PEDF; PIG35
• Note: Immunogen sequence homology: Human: 100%; Mouse: 86%; Sheep: 86%; Guinea pig: 80%; Horse: 80%; Pig: 80%; Dog: 78%; Rat: 75%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein