Thyrotropin Releasing Hormone (TRH) Rabbit Polyclonal Antibody

SKU TA330017

Rabbit Polyclonal Anti-TRH Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRH antibody: synthetic peptide directed towards the C terminal of human TRH. Synthetic peptide located within the following region: RALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 26 kDa
• Gene Name: thyrotropin releasing hormone
• Database Link:
  NP_009048
  P20396
• Background: TRH functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems.
• Synonyms: Pro-TRH; TRF
• Note: Immunogen sequence homology: Bovine: 100%; Human: 100%; Zebrafish: 92%; Guinea pig: 84%; Chicken: 78%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein