APBA1 Rabbit Polyclonal Antibody

SKU TA330004

Rabbit Polyclonal Anti-APBA1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human, Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-APBA1 antibody: synthetic peptide directed towards the N terminal of human APBA1. Synthetic peptide located within the following region: PPQQQHYVGRHQRGRALEDLRAQLGQEEEERGECLARSASTESGFHNHTD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 93 kDa
• Gene Name: amyloid beta precursor protein binding family A member 1
• Database Link:
  NP_001154
  Q02410
• Background: APBA1 is a member of the X11 protein family. It is a neuronal adaptor protein that interacts with the Alzheimer's disease amyloid precursor protein (APP). It stabilises APP and inhibits production of proteolytic APP fragments including the A beta peptide that is deposited in the brains of Alzheimer's disease patients. APBA1 is believed to be involved in signal transduction processes. It is also regarded as a putative vesicular trafficking protein in the brain that can form a complex with the potential to couple synaptic vesicle exocytosis to neuronal cell adhesion.
• Synonyms: D9S411E; LIN10; MINT1; X11; X11A; X11ALPHA
• Note: Immunogen sequence homology: Human: 100%

Reference Data