Bhlhe23 Rabbit Polyclonal Antibody

SKU TA329973

Rabbit Polyclonal Anti-Bhlhb4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Bhlhb4 antibody: synthetic peptide directed towards the n terminal of mouse Bhlhb4. Synthetic peptide located within the following region: MAELKSLSGDSYLALSHSYTATGHAYAAARGPETTRGFGASGPGGDLPAA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 24 kDa
• Gene Name: basic helix-loop-helix family, member e23
• Database Link:
  NP_542372
  Q8BGW3
• Background: May function as transcriptional repressor. May modulate the expression of genes required for the differentiation and/or maintenance of pancreatic and neuronal cell types. May be important for rod bipolar cell maturation.
• Synonyms: bA305P22.3; Beta4; bHLHB4
• Note: Immunogen sequence homology: Mouse: 100%; Rat: 93%

Reference Data