Nmral1 Rabbit Polyclonal Antibody

SKU
TA329936
Rabbit Polyclonal Anti-Nmral1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Nmral1 antibody: synthetic peptide directed towards the n terminal of mouse Nmral1. Synthetic peptide located within the following region: GATGAQGGSVARALLEDGTFRIRVVTRNPEQRAAKELKQQGAEVVRGDQD
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 34 kDa
Gene Name NmrA-like family domain containing 1
Database Link
Background Nmral1 is a redox sensor protein. Nmral1 undergoes restructuring and subcellular redistribution in response to changes in intracellular NADPH/NADP+ levels. At low NADPH concentrations the protein is found mainly as a monomer, and binds argininosuccinate synthase (ASS1), the enzyme involved in nitric oxide synthesis. Association with ASS1 impairs its activity and reduces the production of nitric oxide, which subsecuently prevents apoptosis. Under normal NADPH concentrations, the protein is found as a dimer and hides the binding site for ASS1. The homodimer binds one molecule of NADPH.Nmral1 has higher affinity for NADPH than for NADP+. Binding to NADPH is necessary to form a stable dimer.
Synonyms FLJ25918; HSCARG; SDR48A1
Note Immunogen sequence homology: Mouse: 100%; Pig: 86%; Rat: 86%; Dog: 79%; Bovine: 79%
Reference Data
Write Your Own Review
You're reviewing:Nmral1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.