Elp4 Rabbit Polyclonal Antibody

SKU TA329925

Rabbit Polyclonal Anti-Elp4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Elp4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FMAEGIINGHTLLVASAKENPAKILQELPAPLLDDNSKKELEDVHSAKTP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: elongator acetyltransferase complex subunit 4
• Database Link:
  NP_076365
  Q9ER73
• Background: Elp4 acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.
• Synonyms: C11orf19; dJ68P15A.1; FLJ20498; hELP4; PAX6NEB; PAXNEB
• Note: Immunogen sequence homology: Mouse: 100%; Rat: 92%

Reference Data