Elp4 Rabbit Polyclonal Antibody

SKU TA329924

Rabbit Polyclonal Anti-ELP4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ELP4 antibody: synthetic peptide directed towards the middle region of mouse ELP4. Synthetic peptide located within the following region: QKSVYAEGFDGANPQKKQKNILRIGIQNLGSPLWGDDICCKENCDNNHRL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: elongator acetyltransferase complex subunit 4
• Database Link:
  NP_076365
  Q9ER73
• Background: Elongator is a histone acetyltransferase complex that associates with the elongating form of RNA polymerase II. The human homologue of yeast ELP4 is a component of enlogator and show that this gene is ubiquitously expressed in human tissues.
• Synonyms: C11orf19; dJ68P15A.1; FLJ20498; hELP4; PAX6NEB; PAXNEB
• Note: Immunogen sequence homology: Mouse: 100%; Horse: 91%; Rat: 90%; Dog: 79%; Pig: 79%; Human: 79%; Bovine: 79%; Rabbit: 79%

Reference Data