ZNF691 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF691 antibody: synthetic peptide directed towards the N terminal of human ZNF691. Synthetic peptide located within the following region: GSEKEQSPEPHLPEEGEGGKPWRVDDSEGSWIPPGEKEHGQESLSDELQE |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 33 kDa |
Gene Name | zinc finger protein 691 |
Database Link | |
Background | ZNF691 may be involved in transcriptional regulation |
Synonyms | Zfp691 |
Note | Immunogen sequence homology: Human: 100%; Pig: 92%; Rat: 92%; Bovine: 92%; Dog: 83%; Horse: 83%; Mouse: 83%; Rabbit: 83% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.