RNF186 Rabbit Polyclonal Antibody

CAT#: TA329880

Rabbit Polyclonal Anti-RNF186 Antibody

Product Images

WB Suggested Anti-RNF186 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RNF186 antibody: synthetic peptide directed towards the N terminal of human RNF186. Synthetic peptide located within the following region: MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: ring finger protein 186
• Database Link:
  NP_061935
  Entrez Gene 54546 Human
  UniProt ID Q9NXI6
• Background: The specific function of RNF186 is not yet known.
• Synonyms: RP11-91K11.1
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane