KIAA1333 (G2E3) Rabbit Polyclonal Antibody

CAT#: TA329864

Rabbit Polyclonal Anti-G2E3 Antibody

Product Images

WB Suggested Anti-KIAA1333 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIAA1333 antibody: synthetic peptide directed towards the N terminal of human KIAA1333. Synthetic peptide located within the following region: IWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 80 kDa
• Gene Name: G2/M-phase specific E3 ubiquitin protein ligase
• Database Link:
  NP_060239
  Entrez Gene 55632 Human
  UniProt ID Q7L622
• Background: KIAA1333 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
• Synonyms: KIAA1333; PHF7B
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors