SEMCAP3 (PDZRN3) Rabbit Polyclonal Antibody

SKU TA329848

Rabbit Polyclonal Anti-PDZRN3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PDZRN3 antibody is: synthetic peptide directed towards the N-terminal region of Human PDZRN3. Synthetic peptide located within the following region: ELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 80 kDa
• Gene Name: PDZ domain containing ring finger 3
• Database Link:
  NP_055824
  Q9UPQ7
• Background: PDZRN3 is a E3 ubiquitin-protein ligase. It plays an important role in regulating the surface level of MUSK on myotubes. It mediates the ubiquitination of MUSK, promoting its endocytosis and lysosomal degradation. It might contribute to terminal myogenic differentiation.
• Synonyms: LNX3; SEMACAP3; SEMCAP3
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome