ZNF364 (RNF115) Rabbit Polyclonal Antibody

SKU TA329840

Rabbit Polyclonal Anti-RNF115 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF364 antibody: synthetic peptide directed towards the C terminal of human ZNF364. Synthetic peptide located within the following region: PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: ring finger protein 115
• Database Link:
  NP_055270
  Q9Y4L5
• Background: ZNF364 contains 1 RING-type zinc finger. The exact function of ZNF364 remains unknown.
• Synonyms: BCA2; ZNF364
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome