nkx6.2 (NKX6-2) Rabbit Polyclonal Antibody

SKU TA329659

Rabbit Polyclonal anti-NKX6

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NKX6-2 antibody is: synthetic peptide directed towards the N-terminal region of Human NKX6-2. Synthetic peptide located within the following region: PLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDIL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 29 kDa
• Gene Name: NK6 homeobox 2
• Database Link:
  NP_796374
  Q9C056
• Background: The function of this protein remains unknown.
• Synonyms: GTX; NKX6.2; NKX6B
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Human: 100%; Pig: 93%; Guinea pig: 93%; Mouse: 86%

Reference Data

• Protein Families: Transcription Factors