SPT3 (SUPT3H) Rabbit Polyclonal Antibody

SKU
TA329655
Rabbit Polyclonal anti-SUPT3H antibody
$525.00
5 Days*
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SUPT3H antibody: synthetic peptide directed towards the N terminal of human SUPT3H. Synthetic peptide located within the following region: MRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKI
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 36 kDa
Gene Name SPT3 homolog, SAGA and STAGA complex component
Database Link
Background SUPT3H is a component of the multiprotein SPT-ADA-GCN5 acetyltransferase (SAGA) complex that integrates proteins with transcription coactivator/adaptor functions (ADAs and GCN5), histone acetyltransferase activity (GCN5), and core promoter-selective functions (SPTs) involving interactions with the TATA-binding protein (TBP).
Synonyms SPT3; SPT3L
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Goat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families Stem cell - Pluripotency, Transcription Factors
Write Your Own Review
You're reviewing:SPT3 (SUPT3H) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.