SPT3 (SUPT3H) Rabbit Polyclonal Antibody

CAT#: TA329655

Rabbit Polyclonal anti-SUPT3H antibody

Product Images

WB Suggested Anti-SUPT3H Antibody Titration: 0.4ug/ml; ELISA Titer: 1:1562500; Positive Control: HepG2 cell lysateSUPT3H is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Rabbit Anti-SUPT3H Antibody; Paraffin Embedded Tissue: Human Liver; Cellular Data: Hepatocytes; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SUPT3H antibody: synthetic peptide directed towards the N terminal of human SUPT3H. Synthetic peptide located within the following region: MRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: SPT3 homolog, SAGA and STAGA complex component
• Database Link:
  NP_003590
  Entrez Gene 8464 Human
  UniProt ID O75486
• Background: SUPT3H is a component of the multiprotein SPT-ADA-GCN5 acetyltransferase (SAGA) complex that integrates proteins with transcription coactivator/adaptor functions (ADAs and GCN5), histone acetyltransferase activity (GCN5), and core promoter-selective functions (SPTs) involving interactions with the TATA-binding protein (TBP).
• Synonyms: SPT3; SPT3L
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Goat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Stem cell - Pluripotency, Transcription Factors