ZNF496 Rabbit Polyclonal Antibody

SKU TA329649

Rabbit Polyclonal anti-ZNF496 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF496 antibody: synthetic peptide directed towards the middle region of human ZNF496. Synthetic peptide located within the following region: QEKPHECSVCGELFSDSEDLDGHLESHEAQKPYRCGACGKSFRLNSHLLS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 67 kDa
• Gene Name: zinc finger protein 496
• Database Link:
  NP_116141
  Q96IT1
• Background: ZNF496 contains a SCAN box, a KRAB-A domain, and four consensus C2H2-type zinc fingers preceded by a unique finger derivative, referred to herein as the C2HR motif. The C2HR motif functions to mediate protein-protein interaction with the cysteine-rich (C5HCH) domain of NSD1 in a Zn(II)-dependent fashion, and when tethered to RNA polymerase II promoters, represses transcription in an NSD1-dependent manner. ZNF496 contains a novel type of zinc finger motif that functions as a docking site for NSD1 and is more than just a degenerate evolutionary remnant of a C2H2 motif.
• Synonyms: NIZP1; ZFP496; ZKSCAN17; ZSCAN49
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Horse: 86%; Sheep: 86%; Bovine: 86%

Reference Data

• Protein Families: Transcription Factors