FIZ1 Rabbit Polyclonal Antibody

SKU TA329641

Rabbit Polyclonal anti-FIZ1 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FIZ1 antibody: synthetic peptide directed towards the middle region of human FIZ1. Synthetic peptide located within the following region: LAAHWAAHTDVKPFKCPRCERDFNAPALLERHKLTHDLQGPGAPPAQAWA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 52 kDa
• Gene Name: FLT3 interacting zinc finger 1
• Database Link:
  NP_116225
  Q96SL8
• Background: FIZ1 is zinc finger protein, which interacts with a receptor tyrosine kinase involved in the regulation of hematopoietic and lymphoid cells. FIZ1 also interacts with a transcription factor that regulates the expression of rod-specific genes in retina.
• Synonyms: ZNF798
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 86%; Rat: 79%; Mouse: 79%

Reference Data