Txlng Rabbit Polyclonal Antibody

SKU TA329630

Rabbit polyclonal anti-Txlng antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Txlng antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KADMVCNSQANDILQHQDPSCGGTTKKHSLEGDEGSDFITKNRNLVSSVF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 60 kDa
• Gene Name: taxilin gamma
• Database Link:
  NP_849266
  Q8BHN1
• Background: 4932441K18Rik may be involved in intracellular vesicle traffic.4932441K18Rik inhibits ATF4-mediated transcription, possibly by dimerizing with ATF4 to form inactive dimers that cannot bind DNA.4932441K18Rik may be involved in regulating bone mass density through an ATF4-dependent pathway. 4932441K18Rik may be involved in cell cycle progression.
• Synonyms: 4932441K18Rik; Fiat; Lrp; MGC116250
• Note: Immunogen sequence homology: Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 92%; Human: 92%; Bovine: 79%

Reference Data