Zkscan17 Rabbit Polyclonal Antibody

SKU TA329602

Rabbit polyclonal anti-Zkscan17 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Zkscan17 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GKIFRWRVNFIRHLRSRREQKPHKCSVCGELFSDSEDLDGHLETHEAQKP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 66 kDa
• Gene Name: zinc finger with KRAB and SCAN domains 17
• Database Link:
  NP_766529
  Q5SXI5
• Background: Zkscan17 is a DNA-binding transcription factor that can both act as an activator and a repressor.
• Synonyms: BC040205; D130067D09; Nizp1; RP23-210M6.6; Zfp496; Znf496
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%

Reference Data